PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.8G097100.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 358aa    MW: 39171.6 Da    PI: 9.9458
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.8G097100.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1254e-082292671755
                         HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                         A+rsR RK+++i+eLe +v++L++e  +   e+e l+++
  Sevir.8G097100.2.p 229 AQRSRVRKLQYIAELEGRVQALQSEGVDVSAEMEFLTQQ 267
                         89***********************99999998888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-6218277IPR004827Basic-leucine zipper domain
CDDcd147036.58E-14219269No hitNo description
SuperFamilySSF579593.58E-6228271No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-5229270No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MMMANAKLQK QALLPPRSPF PTAAAPSPYA DRGPIARPQG AAAAHHRHGH GHHQRTSSES  60
FIEEQPPSWL DDLLNEPETP AARQHGRAGH RRSSSDSFAL FDTGAASAGA YSNGFEGMGG  120
GGGQPAPWGG VQEYYAKSGS FGRAHGRPWE QGMPHLAGFR HGGGLPMPAK DKVGGHHGPP  180
NALRDHDHGM DKRTPGDAGH DQKVGAKEGV LPKHAQSEAD NKRAKQQYAQ RSRVRKLQYI  240
AELEGRVQAL QSEGVDVSAE MEFLTQQNII LDLENKALKQ RLESLAQEQL IKRFQQEMFE  300
REIGRLRSLY QQQQQQQQSP VLVRSNSRDL DAQFANLTLK HKDPNSGRDA LSGSLRT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004979095.10.0PREDICTED: uncharacterized protein At4g06598-like
TrEMBLK3ZJ080.0K3ZJ08_SETIT; Uncharacterized protein
STRINGSi026561m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.22e-56bZIP family protein